CiteAb - Data Accelerating Science Data Accelerating Science
Menu
  • Reagent Search
    • Antibodies
      Recombinant, monoclonal & polyclonal antibodies and primary & secondary antibodies.
    • Biochemicals
      Carbohydrates, peptides, bioactive small molecules, buffers, dyes and lipids.
    • Cell Lines & Models
      Cell lines, tissues, bacteria & viruses, and animal models.
    • Kits & Assays
      ELISAs, multiplex immunoassay kits, detection/staining kits and conjugation/labelling kits.
    • Instruments
      Microscopes, flow cytometers, spectrometers, and other laboratory instruments.
    • Nucleotides
      Plasmids, primers, RNA, siRNA, shRNA, gRNA, viral vectors and particles.
    • Proteins
      Enzymes, growth factors, binding proteins (e.g. streptavidin) and protein mixtures (e.g. bovine serum).
  • Image Search
  • Custom Suppliers
    • Antibody Suppliers
      Polyclonal, monoclonal, recombinant or alternative affinity reagent production.
    • Cell line Suppliers
      Knockout cell lines, knockin cell lines, gene activation & repression and reporter cell lines.
    • Histology Suppliers
      Immunohistochemistry (IHC), in situ hybridisation (ISH), tissue microarray staining (TMA), and more.
    • Peptides Suppliers
      Standard and modified sequences, fluorescent, isotope and radioactive labelled peptides, and more.
    • Sequencing Suppliers
      Whole Genome Sequencing, Antibody Sequencing, Targeted Sequencing, and more.
  • Supplier Partnerships
  • Data Services
    • Reagent Suppliers
      Powerful life science market data, accurate product citations & published images and listing on our popular reagent search engine.
    • Pharma, Biotech & Academic Research Institutions
      Accelerate preclinical research by licensing our comprehensive life science reagent database for totally flexible and private use.
    • Investment, Research & Advisory Companies
      Power unique and quantitative analysis into life science reagent and equipment manufacturer performance to help you make more informed investment decisions.
    • Scientific Publishers
      Partner with CiteAb to maximise exposure, researcher benefit and revenue from your publications.
  • Sign in or Register
Sign in or Register
Comments

(LS-G118251) F13B / TGase Protein (Over-Expression Lysate Myc + DDK) (Full Length)

A human enzyme, supplied by LSBio.

Go to:
Supplier info
0 citations

General Information

Supplier
LSBio
Expression System
Homo sapiens
Classification
Enzyme
Protein Name
Coagulation factor XIII B chain
UniProt ID
P05160 - F13B_HUMAN
Species
Homo sapiens (Human)
Gene
F13B
Sequence Length
Full length

Supplier provided information

Applications

None provided

Reactivity

None provided


Additional product information

Sequence

MRLKNLTFIIILIISGELYAEEKPCGFPHVENGRIAQYYYTFKSFYFPMSIDKKLSFFCLAGYTTESGRQEEQTTCTTEGWSPEPRCFKKCTKPDLSNGYISDVKLLYKIQENMRYGCASGYKTTGGKDEEVVQCLSDGWSSQPTCRKEHETCLAPELYNGNYSTTQKTFKVKDKVQYECATGYYTAGGKKTEEVECLTYGWSLTPKCTKLKCSSLRLIENGYFHPVKQTYEEGDVVQFFCHENYYLSGSDLIQCYNFGWYPESPVCEGRRNRCPPPPLPINSKIQTHSTTYRHGEIVHIECELNFEIHGSAEIRCEDGKWTEPPKCIEGQEKVACEEPPFIENGAANLHSKIYYNGDKVTYACKSGYLLHGSNEITCNRGKWTLPPECVENNENCKHPPVVMNGAVADGILASYATGSSVEYRCNEYYLLRGSKISRCEQGKWSSPPVCLEPCTVNVDYMNRNNIEMKWKYEGKVLHGDLIDFVCKQGYDLSPLTPLSELSVQCNRGEVKYPLCTRKESKGMCTSPPLIKHGVIISSTVDTYENGSSVEYRCFDHHFLEGSREAYCLDGMWTTPPLCLEPCTLSFTEMEKNNLLLKWDFDNRPHILHGEYIEFICRGDTYPAELYITGSILRMQCDRGQLKYPRCIPRQSTLSYQEPLRT(CloningSiteandTags:myc-FLAG tag)

Protein Names

Coagulation factor XIII B chain, Fibrin-stabilizing factor B subunit, Protein-glutamine gamma-glutamyltransferase B chain, Transglutaminase B chain, F13B_HUMAN

UniProt Code History

P05160, A8K3E5, Q5VYL5

Gene

F13B, FXIIIB


View additional product information

Comments

for this reagent

Add your comment here...
Enabling you to share comments privately within your lab, helping to avoid duplicated effort.
Get free early access and help us shape this new feature. Join the private beta

0 images
0 citations

found in the literature

Applications
  • None Available
Reactivity
  • None Available
Dilutions
  • None Available

Published images

We have not yet identified suitable images that show this product being used, more are being added all the time.

Loading published images for this product
LSBio logo
  • info@LSBio.com
  • (206) 374-1102
  • 2 Shaker Rd Suites B001/B101 Shirley, MA 01464

Custom Peptides

If you can't find the peptide you're looking for, why not consider a custom reagent from one of these suppliers.

Custom peptide suppliers

Calculators

A collection of useful calculators with more to come!

Use dilution calculator

Report a Problem

Spotted a mistake? Please let us know so that we can put it right!

Report a problem

Join thousands of people who already enjoy the CiteAb newsletter

Stay up to date with improvements to the CiteAb Explore Platform and data services, news of our partnerships, product launches and the CiteAb Awards, and get our latest market data analysis straight to your inbox.

Sign up
×

We just need a few more details to better tailor our newsletter to you:

CiteAb Explore Platform
  • Image search engine
  • Antibody search engine
  • Biochemical search engine
  • Cell Lines & Models search engine
  • Kits & Assays search engine
  • Instruments search engine
  • Nucleotide search engine
  • Protein search engine
  • Custom suppliers
  • Request a Demo
Research Resources
  • Antibody dilution calculator
  • Molarity calculator
  • Finding the right antibody
  • Citing an antibody
Data Licensing
  • Pharma/Biotech
  • Finance
  • Publishers
  • Integrations
Market Data
  • Antibody market data
  • Biochemical market data
  • Cell Lines & Models market data
  • Instrument market data
  • Kits & Assay market data
  • Protein market data
Supplier Partnerships
  • Citation & Image Provision
  • Listing on CiteAb
  • Market Data
  • Case Studies
CiteAb Information
  • Our story
  • Blog
  • Contact
  • Careers
  • CiteAb publications
  • CiteAb awards
  • Facebook
  • LinkedIn
  • Instagram
The world's largest antibody search engine, with results ranked by citations.

Data Accelerating Science

CiteAb helps researchers find reliable reagents through the Explore Platform, combining powerful reagent and image search tools. We also license our world-class data to pharma & biotech companies, investors and sci-tech companies, and partner with leading life science suppliers.

Publication metadata is provided by PubMed®, a database of the US National Library of Medicine. PubMed® is a registered trademark of US National Library of Medicine.

Company registered in England #08530854. VAT #179706954.
Copyright © CiteAb Ltd 2026. All rights reserved.

  • Privacy policy
  • Cookie policy
  • Terms of use
  • Subscription Terms and Conditions

In partnership with:

  • Storm Consultancy
  • University of Bath
Proud recipient of the Queen's Award for Innovation 2022